PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009600194.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 468aa    MW: 52068.1 Da    PI: 9.2667
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009600194.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.72.1e-32192248360
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     DgynWrKYGqK+vkgse+prsYY+Ct+ +Cpvkkkvers  d+++ ei+Y+geHnh+k
  XP_009600194.1 192 DGYNWRKYGQKQVKGSEYPRSYYKCTHLKCPVKKKVERSF-DGQIAEIVYRGEHNHPK 248
                     9***************************************.***************85 PP

2WRKY100.51e-31384441259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dg++WrKYGqK+vkgs +prsYYrCts++C+++k ver+++dpk++++tYeg+Hnh+
  XP_009600194.1 384 EDGFRWRKYGQKVVKGSSYPRSYYRCTSPKCNMRKFVERTTDDPKAFITTYEGKHNHS 441
                     7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-29180249IPR003657WRKY domain
SuperFamilySSF1182902.48E-25189249IPR003657WRKY domain
SMARTSM007744.1E-36190248IPR003657WRKY domain
PfamPF031066.4E-25192247IPR003657WRKY domain
PROSITE profilePS5081123.697192249IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-31374443IPR003657WRKY domain
SuperFamilySSF1182902.09E-27378443IPR003657WRKY domain
PROSITE profilePS5081132.535378443IPR003657WRKY domain
SMARTSM007741.5E-35383442IPR003657WRKY domain
PfamPF031063.8E-25384440IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MEVNEGAKIA IARPVASRPR CPIYKSFSEL LAGAIDISST DVHSEMAITA IRPKTVRLKP  60
ATNNALVDDL SSQVDMSGAP VGSRSDNILQ LLEKPKVLFK PMAKHAPRKT IPLLENKGSF  120
ASDQQQEIAE AEAHVQSANE VKQQHDHTTE SQQSLLAKSD KKIVHSTIVS ENTEEVEQSL  180
INTSNVDRPS YDGYNWRKYG QKQVKGSEYP RSYYKCTHLK CPVKKKVERS FDGQIAEIVY  240
RGEHNHPKPQ PPKRNLSDGQ GRAAVCNDTS KGTNNPSWSN LLPQTSEAYV CRMENQNDVG  300
LSMHSAYSSK APCFYDSIAA AGMHTAARNS EDSAEGSKKL EATCDEPKTK RRKIEGQSNG  360
AGTSGESEFP YMPNQNTTDS EITEDGFRWR KYGQKVVKGS SYPRSYYRCT SPKCNMRKFV  420
ERTTDDPKAF ITTYEGKHNH SVPNRRPNSE ASKTSSKSST IKEKSYVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-29183443177Probable WRKY transcription factor 4
2lex_A4e-29183443177Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600193.10.0PREDICTED: WRKY transcription factor 44
RefseqXP_009600194.10.0PREDICTED: WRKY transcription factor 44
TrEMBLM1AR980.0M1AR98_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000285300.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.12e-87WRKY family protein